DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Prss55

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:248 Identity:80/248 - (32%)
Similarity:115/248 - (46%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI----SEPVGMSIIAGLH-- 95
            :|.|.|||....|:.||:..:   ..|.|||:::::.||:|.|||.    ..|..:.:..|.:  
Mouse    61 IIEGQEAELGEFPWQVSIQES---DHHFCGGSILSEWWILTVAHCFYAQELSPTDLRVRVGTNDL 122

  Fly    96 --TRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATL---PSREQVHE 155
              :..|::..|..|...|.|::.       ..|||||.:.:...|||...|..|   |:....| 
Mouse   123 TTSPVELEVTTIIRHKGFKRLNM-------DNDIALLLLAKPLTFNELTVPICLPLWPAPPSWH- 179

  Fly   156 GETHLYGWGQPKSYIFSGAKT-LQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNG 219
             |..:.|||...|.......| |..|..:|:.:|||.:..|.   :..:.:|:|...:|..||.|
Mouse   180 -ECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEECLQMFPS---LTTNMLCASYGNESYDACQG 240

  Fly   220 DSGGPLVVEFTNAPSE---LIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNI 269
            |||||||.  |..|..   .:||:|||. .||....|.|||.::.|..||..|
Mouse   241 DSGGPLVC--TTDPGSRWYQVGIISWGK-SCGKKGFPGIYTVLAKYTLWIEKI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 79/246 (32%)
Tryp_SPc 37..266 CDD:214473 77/243 (32%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.