DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk5

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:239 Identity:68/239 - (28%)
Similarity:112/239 - (46%) Gaps:17/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPY--IVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAE 99
            ::||::.:..:.|:  .:.|..|.|    .||..||:..|::||||| .:|| ..|..|.|:.:.
Mouse    68 IVNGSDCQKDAQPWQGALLLGPNKL----YCGAVLISPQWLLTAAHC-RKPV-FRIRLGHHSMSP 126

  Fly   100 VDELTQQRQVDFGRV-HEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGW 163
            |.|..||.......: |..|:......|:.|:.:|.....:..|:|..:............:.||
Mouse   127 VYESGQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIRDSHSVKPVEIACDCATEGTRCMVSGW 191

  Fly   164 GQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVE 228
            |...|...:..|.||.:...:|:.|.||...|  ..|.::..|:.. ::.:.:|.||||||:|..
Mouse   192 GTTSSSHNNFPKVLQCLNITVLSEERCKNSYP--GQIDKTMFCAGD-EEGRDSCQGDSGGPVVCN 253

  Fly   229 FTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNIQSA 272
                 .:|.|:||||..||...|.|.:||.:..::.||.:..::
Mouse   254 -----GKLQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDTMNS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 68/234 (29%)
Tryp_SPc 37..266 CDD:214473 66/231 (29%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.