DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG17242

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:272 Identity:65/272 - (23%)
Similarity:107/272 - (39%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKD 73
            ::.||:.||              .|..|...|.|    .||:..|:..|   ..|.|||.:.::|
  Fly     6 ILLLVSIAQ--------------IAADFKSIGIE----QAPWQASVQIN---DKHHCGGVIYSED 49

  Fly    74 WIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTG-------------GVGPY 125
            .|:|.|.|:             .:|.::.::    |..|...|...|             |:.|.
  Fly    50 IILTIAECV-------------RKARLEFIS----VRVGSAQENAGGTVLKVEKMRLQVLGLRPS 97

  Fly   126 DIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEEC 190
            |:|:|.:......:..::...|.:...|......:.|||| .|.:...::.|..|..:|.:...|
  Fly    98 DVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWGQ-LSAMNPSSEVLLRVDVKIQDQLMC 161

  Fly   191 KEELP-ESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPS 254
            ...|. :...::...||::...:...||.|..|||||     |.:.|.||:|| ...|.:.|..|
  Fly   162 ATNLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLV-----ANNRLYGILSW-QSACDVLNKSS 220

  Fly   255 IYTKVSAYIDWI 266
            :|..::.:..||
  Fly   221 VYANIAMFKVWI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 59/244 (24%)
Tryp_SPc 37..266 CDD:214473 57/242 (24%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 58/240 (24%)
Tryp_SPc 24..232 CDD:214473 56/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.