DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG17234

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:242 Identity:72/242 - (29%)
Similarity:109/242 - (45%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSI-IAGLHTRAEV 100
            :|.|........|:.|||  .|. ..|:|||::.:::.|||||||..:..|..: ..|...||. 
  Fly    27 IIGGEPIGIEQVPWQVSL--QYF-GDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG- 87

  Fly   101 DELTQQR--QVDFGR--VHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLY 161
            ..||...  .||...  :||:|...:...|||::.::....|...|||..|............:.
  Fly    88 SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVS 152

  Fly   162 GWGQPKSYIFSGAKT-----LQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDS 221
            |||  .|||.:.:..     ||.:...|.:...|:...|       |.:|:.:  ..::||:|||
  Fly   153 GWG--VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-------SLLCAGT--YGRTACHGDS 206

  Fly   222 GGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITN 268
            ||||||.     .:|:|:||||...|..:   :.:..|..:.:||.|
  Fly   207 GGPLVVN-----KQLVGVVSWGRKGCVSS---AFFVSVPYFREWILN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 72/242 (30%)
Tryp_SPc 37..266 CDD:214473 69/238 (29%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/238 (29%)
Tryp_SPc 27..243 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.