DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG17239

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:229 Identity:61/229 - (26%)
Similarity:100/229 - (43%) Gaps:34/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCIS--EPVGMSIIAGLHTRAEVDELT----Q 105
            |.|:..|:..  |...| ||..:.::|.::|||||::  |...:|:..|       ...|    |
  Fly    34 SVPWQASILR--LGRFH-CGAAIYSEDIVITAAHCLTDRETEFLSVRVG-------SSFTFFGGQ 88

  Fly   106 QRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQ---PK 167
            ..:|....:||:|... ...|||::.:.........|....|............:.|||.   .|
  Fly    89 VVRVSSVLLHEEYDQS-WSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGFKK 152

  Fly   168 SYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNA 232
            :|..|    :.:.:..|::.::|:...  ...|.:..||:::  ..|.||:||||||||     :
  Fly   153 NYPMS----ILSASVDIVDQDQCRRSY--GRKITKDMICAAA--PGKDACSGDSGGPLV-----S 204

  Fly   233 PSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            .::|:||||:|. .|.....|.:|..|:....||
  Fly   205 GNKLVGIVSFGK-ECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 61/229 (27%)
Tryp_SPc 37..266 CDD:214473 59/227 (26%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 59/227 (26%)
Tryp_SPc 24..237 CDD:238113 59/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.