DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and tmprss5

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:276 Identity:85/276 - (30%)
Similarity:132/276 - (47%) Gaps:30/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKD 73
            ||||.....|.:     ||| |.     :|.|.||.....|:.|||   |..:.|||||::|...
Zfish   295 VIALKCFECGTR-----AKL-PR-----IIGGVEAALGRWPWQVSL---YYNNRHICGGSIITNQ 345

  Fly    74 WIVTAAHCI-----SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRV--HEKYTGGVGPYDIALLH 131
            ||||||||:     .:.....:.||:.| :.:.:|.|.:.....|:  ::.|.......||||:.
Zfish   346 WIVTAAHCVHNYRLPQVPSWVVYAGIIT-SNLAKLAQYQGFAVERIIYNKNYNHRTHDNDIALVK 409

  Fly   132 VNESFIFNEWVQPATLPSREQVHEGETHLY--GWG--QPKSYIFSGAKTLQTVTTQILNYEECKE 192
            :.....|::.::|..||..:....|.|..:  |||  ||...:.  .:.|:.....:::.::|..
Zfish   410 LKTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGYTQPDDVLI--PEVLKEAPVPLISTKKCNS 472

  Fly   193 ELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYT 257
            ....:..|....:|:...:....||.||||||||.:..|. ..|:|:|||| ..|...|.|.:|:
Zfish   473 SCMYNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENV-WRLVGVVSWG-TGCAEPNHPGVYS 535

  Fly   258 KVSAYIDWITNIQSAY 273
            ||:.::.||.:|..:|
Zfish   536 KVAEFLGWIYDIIESY 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 74/242 (31%)
Tryp_SPc 37..266 CDD:214473 72/239 (30%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 5/10 (50%)
Tryp_SPc 311..544 CDD:214473 72/245 (29%)
Tryp_SPc 312..547 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.