DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and PRTN3

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:279 Identity:77/279 - (27%)
Similarity:122/279 - (43%) Gaps:60/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGG 67
            |.:|.|.:.|..||:.|:                ::.|.||:|||.||:.||.......||.|||
Human    10 LASVLLALLLSGAARAAE----------------IVGGHEAQPHSRPYMASLQMRGNPGSHFCGG 58

  Fly    68 TLINKDWIVTAAHCISE-PVGM-SIIAGLHTRAEVDELTQQR----QVDFGRVHEKYTGGVGPYD 126
            |||:..:::|||||:.: |..: :::.|.| .....|.|||.    ||..    ..|.......|
Human    59 TLIHPSFVLTAAHCLRDIPQRLVNVVLGAH-NVRTQEPTQQHFSVAQVFL----NNYDAENKLND 118

  Fly   127 IALLHVNESFIFNEWVQPATLPSREQ--VHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEE 189
            :.|:.::.....:..|....||.::|  .|..:....|||:..:: ...|:.||.:...::.: .
Human   119 VLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAH-DPPAQVLQELNVTVVTF-F 181

  Fly   190 CKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVS-------WGYIPC 247
            |:..          |||:...::....|.|||||||:.:         ||:.       ||   |
Human   182 CRPH----------NICTFVPRRKAGICFGDSGGPLICD---------GIIQGIDSFVIWG---C 224

  Fly   248 GLANMPSIYTKVSAYIDWI 266
            .....|..:|:|:.|:|||
Human   225 ATRLFPDFFTRVALYVDWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 70/245 (29%)
Tryp_SPc 37..266 CDD:214473 68/243 (28%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.