DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and KLK6

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:267 Identity:84/267 - (31%)
Similarity:126/267 - (47%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSH-I 64
            ||.:.|  |::|:||| .|:..:||            ::|...:..|.||..:|.|:    .| :
Human     1 MKKLMV--VLSLIAAA-WAEEQNKL------------VHGGPCDKTSHPYQAALYTS----GHLL 46

  Fly    65 CGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIAL 129
            |||.||:..|::||||| .:| .:.:..|.|...:.:...:|..|....:|..|.......||.|
Human    47 CGGVLIHPLWVLTAAHC-KKP-NLQVFLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIML 109

  Fly   130 LHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEEL 194
            |.:......:|.:||..|......:....|:.|||:.....|  ..|:|.....:::.|||:...
Human   110 LRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDF--PDTIQCAYIHLVSREECEHAY 172

  Fly   195 PESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKV 259
            |  ..|.::.:|:...:..|.:|.||||||||     ....|.|:||||.||||....|.:||.|
Human   173 P--GQITQNMLCAGDEKYGKDSCQGDSGGPLV-----CGDHLRGLVSWGNIPCGSKEKPGVYTNV 230

  Fly   260 SAYIDWI 266
            ..|.:||
Human   231 CRYTNWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 73/231 (32%)
Tryp_SPc 37..266 CDD:214473 71/229 (31%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.