DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and zgc:100868

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:278 Identity:84/278 - (30%)
Similarity:125/278 - (44%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LITVTLVIALVAAAQG-------AKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLK 60
            ::.|.|.|||:.....       |.|:.:            ::.|..|...:.|:.|||..:   
Zfish     8 IVGVALTIALLTGCDAQLDVCGTAPLNSR------------IVGGQNAPVGAWPWQVSLQRD--- 57

  Fly    61 HSHICGGTLINKDWIVTAAHCISEP--VGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVG 123
            .||.|||:|||..||:|||||...|  .|:.:..||...|..:..:....|.....|..|.....
Zfish    58 GSHFCGGSLINNQWILTAAHCFPNPSTTGLLVYLGLQKLASFESYSMSSAVSNIIKHPNYNSDTE 122

  Fly   124 PYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLY--GWGQPKSYI-FSGAKTLQTVTTQIL 185
            ..||.||.:..:..|:.:::|..|.:.:......|.::  |||...:.: .....|||.|...|:
Zfish   123 DNDITLLQLASTVSFSNYIRPICLAASDSTFFNGTLVWITGWGNTATGVSLPSPGTLQEVQVPIV 187

  Fly   186 NYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELI--GIVSWGYIPCG 248
            ...:| ..|...:.|.::.:|:..||..|.:|.||||||:|   :...|..|  ||||:| ..|.
Zfish   188 GNRKC-NCLYGVSKITDNMVCAGLLQGGKDSCQGDSGGPMV---SKQGSVWIQSGIVSFG-TGCA 247

  Fly   249 LANMPSIYTKVSAYIDWI 266
            ..|.|.:||:||.|..||
Zfish   248 QPNFPGVYTRVSKYQSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 77/237 (32%)
Tryp_SPc 37..266 CDD:214473 75/235 (32%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 75/248 (30%)
Tryp_SPc 37..267 CDD:238113 77/237 (32%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.