DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Prss53

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:230 Identity:66/230 - (28%)
Similarity:102/230 - (44%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LKHSH---ICGGTLINKDWIVTAAHCISEPVGMSII----AGLHTRAEVDELTQQRQVDFGRVHE 116
            ||| |   .|||.|:::..::|||||.   :|...:    .||....|...|.|.      .:|.
  Rat   357 LKH-HGKLACGGALVSEVVVLTAAHCF---IGRQTLEEWSVGLGAGPEEWGLKQL------ILHG 411

  Fly   117 KYTGGVGPYDIALLHVNESFIFNEWVQPATLP-SREQVHEGETHLYGW--GQPKSYIFSGAKTLQ 178
            .||...|.:|:|.|.:.:.......::|..|| :..::.:||   :||  |..:.   :|.....
  Rat   412 AYTHPEGGHDVAFLLLAQPVTLGPGLRPLCLPYADHRLPDGE---HGWVLGLTRE---AGINHPH 470

  Fly   179 TVTTQILNYEECKEELPES----APIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGI 239
            ||...:|....|..:...|    .||....||::.:.:... |.|.||.|||.|. .....|.|:
  Rat   471 TVPVTVLGPMACSRQHAASGSTGVPILPGMICTTVVGEPPH-CEGLSGAPLVHEI-RGTWFLAGL 533

  Fly   240 VSWGYIPCGLANMPSIYTKVSAYIDWITNIQSAYY 274
            .|:|....|.|. |:::..:|||.||::|:....|
  Rat   534 HSFGDTCQGSAK-PAVFAALSAYEDWVSNLDWQVY 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 64/223 (29%)
Tryp_SPc 37..266 CDD:214473 63/220 (29%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 64/222 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.