DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG34130

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:334 Identity:63/334 - (18%)
Similarity:116/334 - (34%) Gaps:121/334 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKH---- 61
            ||.|.....|||:....||..|...             |.:.:..|..|.:.:|..|.::.    
  Fly     1 MKYIREIFSIALLLTEVGAAHSSWW-------------NSSASYLHGRPPVRTLNKNGIRRTSGG 52

  Fly    62 -------------SHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHT-RAEVDELT-------- 104
                         :.:||.:.::..:.:|:|:|            :|: |::::.|:        
  Fly    53 HAVPWLLRIVDGPTFVCGASYLSALYALTSANC------------MHSHRSQMESLSVELVSSDS 105

  Fly   105 -QQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPAT--------LPSREQVHEGETHL 160
             |..|:|             .:|.....:....:..:|..|.|        |.:|.:        
  Fly   106 RQDNQLD-------------SHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLR-------- 149

  Fly   161 YGWGQPKSYI------FSGAKTLQTVT-------------TQILNYEECKEELPESA----PIAE 202
               |...:|:      .|..|:|..|:             .::||...|     :||    .:.|
  Fly   150 ---GNRNNYVTLCTNPLSSYKSLSVVSYGAGPAENVRTEEIEVLNRMIC-----DSAYGNFLLRE 206

  Fly   203 SNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIP-CGLANMPSIYTKVSAYIDWI 266
            :..|:...::| :.|...:|.|:     .|..:|.|||:|.  | |..:|:|.|:|.:.....:|
  Fly   207 TVACAKEFKRS-ADCMFSAGCPV-----TAGDQLCGIVAWS--PACKRSNLPGIFTDIHQVKRFI 263

  Fly   267 TNIQSAYYK 275
            ....|..:|
  Fly   264 LKAISGKHK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 52/290 (18%)
Tryp_SPc 37..266 CDD:214473 51/287 (18%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 46/258 (18%)
Tryp_SPc 53..256 CDD:304450 46/251 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.