DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG11841

DIOPT Version :10

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:104 Identity:25/104 - (24%)
Similarity:51/104 - (49%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VRKEKRKYDK------DIDSLERKKKSKRKRSFDSDSDDS-----DDDSDDSEK-ETKSKKKKKK 109
            :|:||...|:      :.|.|:.:..|:::|....|.|:|     |.|.||.|. :.:.:::::.
  Fly   147 LREEKTSLDEGSSCENEADHLDERPSSEKERFSSQDEDNSKFTDLDSDLDDDEALDHEEEEEEES 211

  Fly   110 AKKLKPQAETDSSEDDSGFDDQPKKKNKPEKESPPVKSK 148
            |...:....|:|.|       :|:|:.:|::.:....||
  Fly   212 ALDEEVDEHTNSGE-------EPRKRGRPKRAARGATSK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..266 CDD:214473 25/104 (24%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 25/104 (24%)

Return to query results.
Submit another query.