DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and intr

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:260 Identity:46/260 - (17%)
Similarity:96/260 - (36%) Gaps:65/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQGAKLSDKLAKLVPSFATGFVING---TEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVT 77
            :.|........:::|:.....:.:|   |||......:::.:   ..::..||.|.||:...::|
  Fly    64 SSGGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRI---LYENKVICSGALISTRLVLT 125

  Fly    78 AAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVH---EKYTGGVGPYDIALLHVNESFIFN 139
            :|.|..           .|..:....:.:.|....|::   ...||.:....:.|||..   :.:
  Fly   126 SALCFP-----------RTLRQPPPRSYKLQASRSRIYSVANLITGAIEDMALLLLHAP---LED 176

  Fly   140 EWVQPATL---PSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEEL--PESAP 199
            .:|.|..|   |.|.  ::..|           ::...:.|:.:.|:::....||...  .|:|.
  Fly   177 PFVHPIDLCESPLRR--NDNVT-----------MYMSQQHLRFLRTKLIPNSNCKRSYAQDENAF 228

  Fly   200 IAESNIC---SSSLQQSKSA--------------------C-NGDSGGPLVVEFTNAPSELIGIV 240
            |.::.:|   |:.|...::|                    | :|...|.|..:...|.:||:.::
  Fly   229 ITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVFKARTELMHLI 293

  Fly   241  240
              Fly   294  293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 44/239 (18%)
Tryp_SPc 37..266 CDD:214473 44/239 (18%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 37/198 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.