DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG10587

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:283 Identity:75/283 - (26%)
Similarity:125/283 - (44%) Gaps:46/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LITVTLVIALVAAAQGAKLSD--KLAKLV--PSFATGFVINGTEAEPHSAPYIVSLATNYLKHSH 63
            |:|..|....|.|....:..|  ||||:|  |.|.|..|............|:::|.   .:.:.
  Fly     9 LLTAPLASIEVLAQDLNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALR---YEMNF 70

  Fly    64 ICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIA 128
            :|||||::...::|||||....|.:|....:...:::::...||||.......::.......|:|
  Fly    71 VCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGASKLNDRGIQRQVKEVIKSAEFREDDMNMDVA 135

  Fly   129 LLH---------VNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQI 184
            :|.         :.:..:..:.:.|.|          |..:.|||..::..|...|.|:|||..:
  Fly   136 ILRLKKPMKGKSLGQLILCKKQLMPGT----------ELRVSGWGLTENSEFGPQKLLRTVTVPV 190

  Fly   185 LNYEECKEE-LP---ES---------APIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSEL 236
            ::.::|:.. ||   ||         ..:.:|..|:..|.: |.||..|||||||.:     :::
  Fly   191 VDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCAGVLGK-KDACTFDSGGPLVYK-----NQV 249

  Fly   237 IGIVSWGYIPCGLANMPSIYTKV 259
            .||||:| |.|.......:||.:
  Fly   250 CGIVSFG-IGCASKRYYGVYTDI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 61/245 (25%)
Tryp_SPc 37..266 CDD:214473 61/245 (25%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 61/247 (25%)
Tryp_SPc 46..280 CDD:238113 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.