DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG11037

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:254 Identity:73/254 - (28%)
Similarity:117/254 - (46%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLAKLV-PSFATGFVING---TEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISE 84
            :|||:| ||.....||.|   |.|:  ...|:.:|   ..:...:|||||:|::.::|||||...
  Fly    48 QLAKIVLPSPHETRVIGGHVTTNAK--LGGYLTAL---LYEDDFVCGGTLLNENIVLTAAHCFLG 107

  Fly    85 PVGMS--IIAGLHTRAEVDELTQ---QRQVDFGRVHEKYTGGVGPYDIALL---------HVNES 135
            .:..|  |:|     |.:..|.|   :|.|....:.|::.......|:|::         ::...
  Fly   108 RMKASEWIVA-----AGISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLKAKNIGTL 167

  Fly   136 FIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPI 200
            .:.:..::|..          |..:.|||............|:|||..|::.:.|:.....:|.|
  Fly   168 SLCSVSLKPGV----------ELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKI 222

  Fly   201 AESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKV 259
            .:|.||::.|.: |.||..|||||||.:     .::.||||:| |.|.....|.:||.|
  Fly   223 TDSMICAAVLGR-KDACTFDSGGPLVFK-----KQVCGIVSFG-IGCASNRYPGVYTDV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 67/240 (28%)
Tryp_SPc 37..266 CDD:214473 67/240 (28%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 67/241 (28%)
Tryp_SPc 62..283 CDD:238113 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.