DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Sems

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:242 Identity:74/242 - (30%)
Similarity:117/242 - (48%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLAKLV--PSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI---S 83
            ||||:|  |::.|..:............|:|  |..|. ::.|||||||::..::|||||.   :
  Fly    30 KLAKIVLPPAYQTRVIGGRVTTNAKLGGYLV--AMRYF-NNFICGGTLIHELIVLTAAHCFEDRA 91

  Fly    84 EPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLP 148
            |....|:..|:   :.:.|...:|||.......::.......|:|::.:|...: .:.:...:|.
  Fly    92 EKEAWSVDGGI---SRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMV-GKNIGTLSLC 152

  Fly   149 SREQVHEGET-HLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQ 212
            | ..:..|:| .:.|||............|:||:..::....|:|...||..|::|..|:|.|.:
  Fly   153 S-TALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGK 216

  Fly   213 SKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKV 259
             |.||..|||||||.|     .::.||||:| |.|.....|.:||.|
  Fly   217 -KDACTYDSGGPLVYE-----KQVCGIVSFG-IGCASRRYPGVYTDV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 67/227 (30%)
Tryp_SPc 37..266 CDD:214473 67/227 (30%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 67/229 (29%)
Tryp_SPc 44..265 CDD:238113 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.