DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Jon74E

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:276 Identity:78/276 - (28%)
Similarity:126/276 - (45%) Gaps:18/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTE-AEPHSAPYIVSLATNYLKHSHI-CGGTL 69
            |:::.|:...||..:|    .|......|..|.|.| |..:..||.|.|:.......:. ||.:|
  Fly     5 TILVFLLILVQGRSIS----CLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASL 65

  Fly    70 INKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNE 134
            |:..:::|||||:.:.|.::...|...|....:|.:....:. .:|..:.......||||:.:.|
  Fly    66 ISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEV-HLHPDWNCQSLENDIALVRLPE 129

  Fly   135 SFIFNEWVQPATLP----SREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELP 195
            ..:..:.::|..||    ||...........|||:......:.:..|:.|...:.:.|:|:... 
  Fly   130 DALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY- 193

  Fly   196 ESAPIAESNICSSSLQQSKSACNGDSGGPLVVE--FTNAPSELIGIVSWGYIPCGLANMPSIYTK 258
              |.|..:|||..: ...||.|.||||||||..  ..|| ..|||:.|:|.........||::|:
  Fly   194 --ANIKPTNICMDT-TGGKSTCTGDSGGPLVYSDPVQNA-DILIGVTSYGKKSGCTKGYPSVFTR 254

  Fly   259 VSAYIDWITNIQSAYY 274
            ::||:|||..:...:|
  Fly   255 ITAYLDWIGEVSGVHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 70/239 (29%)
Tryp_SPc 37..266 CDD:214473 68/236 (29%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.