DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG16998

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:116/266 - (43%) Gaps:26/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLI 70
            :.|::.|:...:.:.||.:..          ::.|.|...|..|::.|:..:   .::.|...||
  Fly     4 LALILLLICGHKTSALSPQER----------IVGGVEVPIHLTPWLASITVH---GNYSCSSALI 55

  Fly    71 NKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNES 135
            ...|:|||.||:..|...|:.||   ....|...|:|.|....:|..:.......|||||.:::|
  Fly    56 TSLWLVTAGHCVQYPDSYSVRAG---STFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKS 117

  Fly   136 FIFNEWVQPATLPSREQVHEGETHLY-GWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPE-SA 198
            |.....:|...||.........|.|. |||.|.:........|:....:::|...|:..... ..
  Fly   118 FTLGGNIQVVKLPLPSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHR 182

  Fly   199 PIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYI 263
            ||.:..:|::.  ..:..|.||||.|||...::     .||||:.: .|...:.|.:||:::.|:
  Fly   183 PITDDMVCAAG--AGRDHCYGDSGAPLVHRGSS-----YGIVSFAH-GCADPHFPGVYTRLANYV 239

  Fly   264 DWITNI 269
            .||.|:
  Fly   240 TWIFNV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 64/233 (27%)
Tryp_SPc 37..266 CDD:214473 62/230 (27%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 62/241 (26%)
Tryp_SPc 25..242 CDD:238113 62/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.