DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG32271

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:122/283 - (43%) Gaps:61/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGG 67
            :.|:.||:.|:.....|.          :.|...::.|...:..|.||:|:|.   :..:.:|||
  Fly     1 MATLWLVLHLIPLCWAAS----------NEANSRIVGGVPVDIASVPYLVNLR---IGGNFMCGG 52

  Fly    68 TLINKDWIVTAAHCISEPVGMS---IIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIAL 129
            :|:....:||||||: :.:|.|   ::||: ||  :.|...:..||.....:.|.......|:|:
  Fly    53 SLVTPQHVVTAAHCV-KGIGASRILVVAGV-TR--LTETGVRSGVDKVYTPKAYNTRTLTSDVAV 113

  Fly   130 LHV---------------NESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQT 179
            |.:               |.||...:.::                :.||||......:.:..:::
  Fly   114 LKLKAPISGPKVSTIELCNTSFKAGDLIK----------------VSGWGQITERNKAVSMQVRS 162

  Fly   180 VTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGY 244
            |...::..:.|..:......|..:..| :|:...|.||.||||||.|.:     .:|.|||||| 
  Fly   163 VDVALIPRKACMSQYKLRGTITNTMFC-ASVPGVKDACEGDSGGPAVYQ-----GQLCGIVSWG- 220

  Fly   245 IPCGLANMPSIYTKVS---AYID 264
            :.|...:.|.:||.|.   ::||
  Fly   221 VGCARKSSPGVYTNVKTVRSFID 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 65/249 (26%)
Tryp_SPc 37..266 CDD:214473 65/249 (26%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 63/247 (26%)
Tryp_SPc 25..244 CDD:238113 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.