DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and KLKB1

DIOPT Version :10

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:243 Identity:78/243 - (32%)
Similarity:119/243 - (48%) Gaps:25/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGM------SIIAGLH 95
            ::.||.:.....|:.|||........|:|||:||...|::|||||..   |:      .|.:|:.
Human   402 IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFD---GLPLQDVWRIYSGIL 463

  Fly    96 TRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHL 160
            ..:::.:.|...|:....:|:.|....|.:||||:.:.....:.|:.:|..|||:.......|:.
Human   464 NLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNC 528

  Fly   161 Y--GWGQPKSYIFSGAK-----TLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACN 218
            :  |||      ||..|     .||.|...::..|||::.. :...|.:..:|:...:..|.||.
Human   529 WVTGWG------FSKEKGEIQNILQKVNIPLVTNEECQKRY-QDYKITQRMVCAGYKEGGKDACK 586

  Fly   219 GDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            ||||||||.:. |....|:||.|||. .|.....|.:||||:.|:|||
Human   587 GDSGGPLVCKH-NGMWRLVGITSWGE-GCARREQPGVYTKVAEYMDWI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..266 CDD:214473 76/241 (32%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 76/241 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.