DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG3650

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:251 Identity:65/251 - (25%)
Similarity:118/251 - (47%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLAKLVPSFATG----FVINGTEAEPHS-APYIVSL---ATNYLKHSHICGGTLINKDWIVTAAH 80
            :|.:|:...|:|    .::.||.....: ..::|:|   .|.|      |||:|:....:|||||
  Fly     9 QLTQLLLGLASGQIQPRIVGGTTTTLSAVGGFVVNLRYDGTFY------CGGSLVTSSHVVTAAH 67

  Fly    81 CIS--EPVGMSIIAGLHTRAEVDELTQQ---RQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNE 140
            |:.  :...:::..|      |.:|:|.   |:|....:...::.....:|:.::.: :|.:...
  Fly    68 CLKGYQASRITVQGG------VSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRL-QSALTGS 125

  Fly   141 WVQPATLP-SREQVHEGE-THLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAES 203
            .:  .|:| .:.|.:.|. ..:.|||..:....|.:..|:||..|::..:.|:........:..|
  Fly   126 GI--TTIPLCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTAS 188

  Fly   204 NICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKV 259
            ..|:.:  ..|.:|:|||||.::  |.|   :|.|||||| :.|..|..|.:||.|
  Fly   189 TFCART--GGKDSCSGDSGGGVI--FKN---QLCGIVSWG-LGCANAQYPGVYTSV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 61/234 (26%)
Tryp_SPc 37..266 CDD:214473 61/234 (26%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 61/235 (26%)
Tryp_SPc 26..243 CDD:238113 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.