DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG32269

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:264 Identity:81/264 - (30%)
Similarity:124/264 - (46%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QGA--KLSDKLAKLVPSFATGF-----VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDW 74
            ||.  |||.|........||..     ::.||.....:.||||.|.    :.|::|.|:||.:.|
  Fly    82 QGTARKLSAKRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLR----RGSNLCSGSLITEQW 142

  Fly    75 IVTAAHCIS--EPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFI 137
            ::|||||:.  .....::..|..|....|.:|  |.|....|..|:|......|.|||.:|:|..
  Fly   143 VLTAAHCVKGYSASDFTVRGGTTTLDGSDGVT--RSVSSIHVAPKFTSKKMNMDAALLKLNQSLT 205

  Fly   138 FNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAE 202
            ... :...::.:..........:.|||..|....:.:|||||...:::..::|:::....|.|.:
  Fly   206 GTN-IGTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITK 269

  Fly   203 SNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWIT 267
            ..:|:.:  ..|.:|:||||||:....|     |:||||:|| .|..|..|.:||.|.|...|.|
  Fly   270 YMLCARA--AGKDSCSGDSGGPVTRNNT-----LLGIVSFGY-GCARAGYPGVYTAVVAIRQWAT 326

  Fly   268 NIQS 271
            ||.:
  Fly   327 NIMA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 71/233 (30%)
Tryp_SPc 37..266 CDD:214473 69/230 (30%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 69/230 (30%)
Tryp_SPc 121..324 CDD:238113 67/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.