DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG32833

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:289 Identity:63/289 - (21%)
Similarity:114/289 - (39%) Gaps:70/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LAKLVPSFATGFVIN------GTEAEPH------------------SAPYIVSLATNYLKHSHIC 65
            |.:.:|.|...||::      |.::|..                  :||:|.|::   :|....|
  Fly     2 LLRSLPIFLALFVLSKSDTGAGEDSEEDDENDCNRTTLGGHPVNITTAPWIASIS---IKQKAKC 63

  Fly    66 GGTLINKDWIVTAAHCISEPVG--MSIIAGLHTRAE------VDELTQQRQVDFGRVHEKYTGGV 122
            .|.:.....||||..|:...:.  :.:..|..||::      |..:|         ||||:||..
  Fly    64 DGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVIEVAVCNIT---------VHEKFTGQT 119

  Fly   123 GPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQP---------KSYIFSGAKTLQ 178
            ..:::|:|.:.|....::.:||..|.::...:..:....||  |         |..:...|..||
  Fly   120 VFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGW--PSFRWWAMYWKKCLDDEAYKLQ 182

  Fly   179 TVTTQILNYEECKEELPES----APIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGI 239
            ....::|...:|.:....:    ....:...|:...  :|.||:...|.|:|..     .:|:||
  Fly   183 KAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKF--AKEACSLAMGSPVVHN-----GKLVGI 240

  Fly   240 VSWGYIPCGLANMPSIYTKVSAYIDWITN 268
            ::.|    |.:..|.:|..:..|.||:.|
  Fly   241 ITKG----GCSEYPEVYINLIKYKDWLHN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 59/277 (21%)
Tryp_SPc 37..266 CDD:214473 57/273 (21%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 56/251 (22%)
Tryp_SPc 40..262 CDD:214473 53/246 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.