DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Ser8

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:274 Identity:85/274 - (31%)
Similarity:131/274 - (47%) Gaps:21/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHIC 65
            |.|:..|. :||:|...||.:...|.....|.. |.::.||.:.....|:.|||..:   .||.|
  Fly     1 MSLLIATF-LALLALTNGAVIPIGLEPQTSSLG-GRIVGGTASSIEDRPWQVSLQRS---GSHFC 60

  Fly    66 GGTLINKDWIVTAAHCISEPVGMS---IIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDI 127
            ||::|:.:.|||||||:..|..:|   |.||.:.|.....|.:...:   :.||.|.......||
  Fly    61 GGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAI---KAHEAYNSNSKINDI 122

  Fly   128 ALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEEC-K 191
            .::.:.....|...::..|:.|....|.....:.|||:..:...|.| ||..|.|:|:...:| .
  Fly   123 GVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSA-TLLFVDTRIVGRSQCGS 186

  Fly   192 EELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIY 256
            ......:.|..:.||:::  .:|.||.||||||||     :..:|:|:||||. .|.:||.|.:|
  Fly   187 STYGYGSFIKATMICAAA--TNKDACQGDSGGPLV-----SGGQLVGVVSWGR-DCAVANYPGVY 243

  Fly   257 TKVSAYIDWITNIQ 270
            ..::...||:...|
  Fly   244 ANIAELRDWVLQAQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 73/235 (31%)
Tryp_SPc 37..266 CDD:214473 72/232 (31%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 72/233 (31%)
Tryp_SPc 35..253 CDD:238113 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.