DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG17571

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:270 Identity:80/270 - (29%)
Similarity:130/270 - (48%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGG 67
            |::|..::||.|:..|....|        |..|.::||.:.:..:.||.||:.|.  |.||.|||
  Fly     5 LLSVVALVALAASCHGNPGLD--------FPFGRIVNGEDVDIENYPYQVSVQTT--KGSHFCGG 59

  Fly    68 TLINKDWIVTAAHCISEPVG--MSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALL 130
            :||:.:.::|||||:.....  :.:..|..:|:...|:...|...:   ||.|...:...|:|::
  Fly    60 SLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKY---HEGYNSKLMINDVAII 121

  Fly   131 HVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELP 195
            .::........::...|...|.|......:.|||.......|...|||.|...:|:|::|..:..
  Fly   122 KLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTY 186

  Fly   196 E--SAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTK 258
            .  |..|.|:.:|::.  :.|.||.||||||||     |.::|:|:|||| ..|.....|.:|..
  Fly   187 NYGSDSILETMVCATG--EKKDACQGDSGGPLV-----ADNKLVGVVSWG-SGCAWTGYPGVYAD 243

  Fly   259 VSAYIDWITN 268
            |::...||.:
  Fly   244 VASLRSWIVD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 71/236 (30%)
Tryp_SPc 37..266 CDD:214473 69/232 (30%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 69/233 (30%)
Tryp_SPc 31..254 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.