DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Send2

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:241 Identity:76/241 - (31%)
Similarity:110/241 - (45%) Gaps:37/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVD 101
            :|.|.......||:.||:..:   ..|:|||::.:.|.|:|||||: :..|..:.||...:....
  Fly    27 IIGGQPIGIEEAPWQVSIQRD---GKHLCGGSIYSADIIITAAHCV-QGQGYQVRAGSALKNSNG 87

  Fly   102 ELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQP 166
            .:.....:   |.||    |:| .|||::.:::...|...|||..|............:.|||. 
  Fly    88 SVVDVAAI---RTHE----GLG-NDIAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGS- 143

  Fly   167 KSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAE-SNICSSSLQQSKSACNGDSGGPLVVEFT 230
            .|| :|....||.|...|        :.|....:.| |.||:.|.  .::||.||||||||.:  
  Fly   144 SSY-YSHPIDLQGVNLYI--------QWPYYCGLTEPSRICAGSF--GRAACKGDSGGPLVFD-- 195

  Fly   231 NAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITN----IQSA 272
               .:|:|:||.|...|   ...||||.|..:.:||.|    |.||
  Fly   196 ---QQLVGVVSGGTKDC---TYSSIYTSVPYFREWILNAIDEIMSA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 73/236 (31%)
Tryp_SPc 37..266 CDD:214473 70/229 (31%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 70/229 (31%)
Tryp_SPc 27..225 CDD:238113 70/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.