DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Phae2

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:267 Identity:97/267 - (36%)
Similarity:144/267 - (53%) Gaps:23/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLVIALVAAAQGAKLS-DKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLI 70
            |:::..|..:||:.|: |:        ..|.|:.|..|..:|||||||:...   .:|.|...:|
  Fly     9 TILLLAVCVSQGSGLALDQ--------PEGRVVGGKAAAANSAPYIVSMQYG---GTHYCAANII 62

  Fly    71 NKDWIVTAAHCI---SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHV 132
            |.:|:||||||:   ::.:|.:::||....|.....||:||:....:::.||||..||||.|::.
  Fly    63 NSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYT 127

  Fly   133 NESFIFNEWVQPATLPSREQVHEGETHLYGWGQ-PKSYIFSGAKTLQTV-TTQILNYEECKEEL- 194
            ..:|.:...|.|..|||......|:..|:|||. .|:...|..||||.. ...|::.:.|...| 
  Fly   128 PTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALG 192

  Fly   195 PESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKV 259
            .:...:..:|:|:..|....|.|..|||||||     ..:.||||||||.:|||..|.||:|.:|
  Fly   193 SKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLV-----QGNVLIGIVSWGKLPCGQPNSPSVYVQV 252

  Fly   260 SAYIDWI 266
            |::|.||
  Fly   253 SSFITWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 90/236 (38%)
Tryp_SPc 37..266 CDD:214473 88/234 (38%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 88/235 (37%)
Tryp_SPc 32..262 CDD:238113 90/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.