DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:240 Identity:70/240 - (29%)
Similarity:121/240 - (50%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHC-----ISEPVGMSIIAGLHT 96
            :|.||:......|:.|||   :...|..||.::|:::|:::||||     :|:|...:...|::.
Human   606 IIGGTDTLEGGWPWQVSL---HFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYV 667

  Fly    97 RAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESF--IFNEWVQPATL-PSREQVHEGE- 157
            :.....::..|::   .|||.|......||||||.::.::  ...:.:||..: |:.::|..|| 
Human   668 QGNAKFVSPVRRI---VVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPTGQRVRSGEK 729

  Fly   158 THLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSG 222
            ..:.|||:.......|:..||....::::...|   :.....|....:|:..:...:.||.||||
Human   730 CWVTGWGRRHEADNKGSLVLQQAEVELIDQTLC---VSTYGIITSRMLCAGIMSGKRDACKGDSG 791

  Fly   223 GPLVV-EFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            |||.. ..::....|.||||||: ..|..|.|.:||:||.::.||
Human   792 GPLSCRRKSDGKWILTGIVSWGH-GSGRPNFPGVYTRVSNFVPWI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 70/240 (29%)
Tryp_SPc 37..266 CDD:214473 68/238 (29%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.