DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and PRSS53

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:195 Identity:54/195 - (27%)
Similarity:87/195 - (44%) Gaps:29/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGTLINKDWIVTAAHCI---SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYD 126
            |||.|::::.::|||||.   ..|...|:  ||.||.|...|.|.      .:|..||...|.||
Human   373 CGGALVSEEAVLTAAHCFIGRQAPEEWSV--GLGTRPEEWGLKQL------ILHGAYTHPEGGYD 429

  Fly   127 IALLHVNESFIFNEWVQPATLPSRE-QVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEEC 190
            :|||.:.:.......::|..||..: .:.:||.   ||...::...:|..:||||...:|....|
Human   430 MALLLLAQPVTLGASLRPLCLPYPDHHLPDGER---GWVLGRARPGAGISSLQTVPVTLLGPRAC 491

  Fly   191 K--EELP--ESAPIAESNICSSSLQQSKSACNGD----SGGPLVVEFTNAPSELIGIVSWGYIPC 247
            .  ...|  :.:||....:|:|::.:..| |..:    ..||     .::..:.:....|.|.||
Human   492 SRLHAAPGGDGSPILPGMVCTSAVGELPS-CEANQPAADRGP-----GHSQDKRMQAGKWHYCPC 550

  Fly   248  247
            Human   551  550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 54/195 (28%)
Tryp_SPc 37..266 CDD:214473 54/195 (28%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113
Tryp_SPc 43..314 CDD:214473
Tryp_SPc 359..>512 CDD:304450 44/149 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.