Sequence 1: | NP_608518.1 | Gene: | CG11911 / 33206 | FlyBaseID: | FBgn0031249 | Length: | 277 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011544118.1 | Gene: | PRSS53 / 339105 | HGNCID: | 34407 | Length: | 623 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 54/195 - (27%) |
---|---|---|---|
Similarity: | 87/195 - (44%) | Gaps: | 29/195 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 CGGTLINKDWIVTAAHCI---SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYD 126
Fly 127 IALLHVNESFIFNEWVQPATLPSRE-QVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEEC 190
Fly 191 K--EELP--ESAPIAESNICSSSLQQSKSACNGD----SGGPLVVEFTNAPSELIGIVSWGYIPC 247
Fly 248 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11911 | NP_608518.1 | Tryp_SPc | 37..269 | CDD:238113 | 54/195 (28%) |
Tryp_SPc | 37..266 | CDD:214473 | 54/195 (28%) | ||
PRSS53 | XP_011544118.1 | Tryp_SPc | 42..316 | CDD:238113 | |
Tryp_SPc | 43..314 | CDD:214473 | |||
Tryp_SPc | 359..>512 | CDD:304450 | 44/149 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D433637at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |