DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG4271

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:237 Identity:71/237 - (29%)
Similarity:115/237 - (48%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI-SEPV-GMSIIAG---LHT 96
            :.||.||:   ..:...||:.::...|.|||.:|:...::|||.|: ::|| .:::..|   ::.
  Fly    19 IYNGVEAK---FDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYR 80

  Fly    97 RAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLY 161
            ...:..:|..      .|||.|..  ...|||||.: |..:.:..|....|.::|..........
  Fly    81 GGRIIRVTAL------VVHENYKN--WDNDIALLWL-EKPVLSVRVTKIPLATKEPSENEYPSNA 136

  Fly   162 GWGQP--KSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGP 224
            |||:.  :||:.:  :.||...|:|.....|.|||.|  |:.|..:|  :.......|.||.|||
  Fly   137 GWGEKLLESYVVT--RKLQNGVTKIRPRSMCAEELVE--PVGEELLC--AFYTENDICPGDYGGP 195

  Fly   225 LVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            ||:     .::::||...|: .||.|.:||:||.|..|::||
  Fly   196 LVL-----ANKVVGIAVQGH-GCGFAVLPSLYTNVFHYLEWI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 71/237 (30%)
Tryp_SPc 37..266 CDD:214473 69/235 (29%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 71/237 (30%)
Tryp_SPc 19..231 CDD:214473 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.