DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Ser12

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:243 Identity:73/243 - (30%)
Similarity:106/243 - (43%) Gaps:54/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PYIVS----LATNYLKHSHICGGTLINKDWIVTAAHCISEP--------VGMSI---IAGLHTRA 98
            |.::|    .|.......:|||..:.:...|:|||||:..|        || |:   :.|.|.|.
  Fly    29 PVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVG-SVWKNLGGQHARV 92

  Fly    99 EVDELTQQRQVDFGRVHEKYTGGVGPY-DIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYG 162
            .|.           |.||.|......: |||::.:.::.|||..|:|..|.........|..:.|
  Fly    93 AVI-----------RKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSG 146

  Fly   163 WG-------QPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGD 220
            ||       ||.|.:.:..|        ||:...||.....   |.::.||:::|  .|.:|:||
  Fly   147 WGEIGILWLQPTSLLKTSVK--------ILDPNVCKRSYQY---ITKTMICAAAL--LKDSCHGD 198

  Fly   221 SGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITN 268
            ||||||     :..:|:||||:| |.|.....|.:|..|:....||.|
  Fly   199 SGGPLV-----SGGQLVGIVSYG-IGCANPFFPGVYANVAELKPWILN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 73/243 (30%)
Tryp_SPc 37..266 CDD:214473 70/239 (29%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 70/239 (29%)
Tryp_SPc 24..238 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.