DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Prss53

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:230 Identity:67/230 - (29%)
Similarity:103/230 - (44%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LKHSH---ICGGTLINKDWIVTAAHCISEPVGMSII----AGLHTRAEVDELTQQRQVDFGRVHE 116
            ||| |   .|||.|:::..::|||||.   :|...:    .||....|...|.|.      .:|.
Mouse   318 LKH-HGKLACGGALVSEVVVLTAAHCF---IGRQTLEEWSVGLGAGPEEWGLKQL------ILHG 372

  Fly   117 KYTGGVGPYDIALLHVNESFIFNEWVQPATLP-SREQVHEGETHLYGW--GQPKSYIFSGAKTLQ 178
            .||...|.||:|.|.:.:.......::|..|| :...:.:||   :||  |..:.   :|....|
Mouse   373 AYTHPEGGYDVAFLLLAQPVTLGPGLRPLCLPYADHHLPDGE---HGWVLGLTQK---AGINYPQ 431

  Fly   179 TVTTQILNYEECKEE--LP--ESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGI 239
            ||...:|....|..:  .|  ...||....:|::.:.:... |.|.||.|||.|. .....|:|:
Mouse   432 TVPVTVLGPMACSRQHAAPGGTGIPILPGMVCTTVVGEPPH-CEGLSGAPLVHEI-RGTWFLVGL 494

  Fly   240 VSWGYIPCGLANMPSIYTKVSAYIDWITNIQSAYY 274
            .|:| ..|..:..|:::..:|||.|||:|:....|
Mouse   495 HSFG-DTCQSSAKPAVFAALSAYEDWISNLDWQVY 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 65/223 (29%)
Tryp_SPc 37..266 CDD:214473 63/220 (29%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 65/222 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.