DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG4653

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:118/277 - (42%) Gaps:57/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINK 72
            |::.:|....|...|.:|                .||..|.|:.:||..|.:   |:|||.||.:
  Fly    12 LLLLVVIVTLGVVQSSRL----------------PAEVGSQPHSISLRRNGV---HVCGGALIRE 57

  Fly    73 DWIVTAAHCISEPVGM--------SIIAGLHTRAEVDELTQQRQVDFGR--VHEKYTG--GVGPY 125
            .||:|||||:|...|.        ::..|     .:..||..:.|...:  :|..|:.  .||..
  Fly    58 KWILTAAHCVSLGGGQQSYPAKSYNVRVG-----SIQRLTGGQLVPLSKIIIHTNYSSSDAVGSN 117

  Fly   126 DIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPK-----SYIFSGAKTLQTVTTQIL 185
            |:|||.:..|.:.|....|..|.:.......:....|||..:     |::      ||..|.|.|
  Fly   118 DLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHV------LQVATRQSL 176

  Fly   186 NYEECKEELPESAPIAESNICSSSLQQS-KSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGL 249
            :..:|:.||...   .|..:|.|.:.:. ...|:||:|.|  ..:.|   :|:||.::....|| 
  Fly   177 SASDCQTELYLQ---QEDLLCLSPVDEDFAGLCSGDAGAP--ASYNN---QLVGIAAFFVSGCG- 232

  Fly   250 ANMPSIYTKVSAYIDWI 266
            :..|..|..|:.:::||
  Fly   233 SEQPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 69/248 (28%)
Tryp_SPc 37..266 CDD:214473 67/246 (27%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/243 (28%)
Tryp_SPc 30..249 CDD:214473 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.