DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG33160

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:240 Identity:67/240 - (27%)
Similarity:105/240 - (43%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI--SEPVGMSIIAGLHTRAE 99
            :|.|..:......|:|.:.|:    ..:|||:|:...|::|||||:  .......|..|...:| 
  Fly    34 IIGGHVSSIKEEKYLVQVTTS----EELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQA- 93

  Fly   100 VDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFI-FNEWVQP---ATLPSREQVHEGETHL 160
             ......|.||:..:...:.......|:|.|.:|...| .|....|   .::|:|..|     .:
  Fly    94 -GPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARALV-----KV 152

  Fly   161 YGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPL 225
            .|||...:.....|:.:.:|...:.:...|.........|..|.:|::.|.: |.:|:|||||||
  Fly   153 SGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYK-KDSCDGDSGGPL 216

  Fly   226 VVEFTNAPSELIGIVSWGYIPCGLAN-MPSIYTKVSAYIDWITNI 269
            |..     .:|.||||:||   |.|: :|.|||.|....||...:
  Fly   217 VYR-----GQLAGIVSFGY---GCASALPGIYTSVPEIRDWFQRV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 67/238 (28%)
Tryp_SPc 37..266 CDD:214473 66/235 (28%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 65/234 (28%)
Tryp_SPc 34..253 CDD:238113 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.