DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG31267

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:288 Identity:75/288 - (26%)
Similarity:135/288 - (46%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLVIALVAAA-------QGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHI 64
            |||:.|:|.:       :.|..|:| ::....|::. ::.|.|::..:|||:|||...|  .:|.
  Fly    10 TLVLVLLALSFSEASLRRRAFTSEK-SETANKFSSR-IVGGEESDVLAAPYLVSLQNAY--GNHF 70

  Fly    65 CGGTLINKDWIVTAAHCISEPVGMSIIAGL-------------HTRAE-----VDELTQQRQVDF 111
            |.|::|:..|::|||.|         :|||             |..:|     |:::......|.
  Fly    71 CAGSIIHDQWVITAASC---------LAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDS 126

  Fly   112 GRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGET-HLYGWGQPKSYIFSG-- 173
            ...|.         ||||:..:..|.:::..|..|:...|.:.:||| .:||:|..:   ..|  
  Fly   127 PMYHN---------DIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTE---IGGDF 179

  Fly   174 AKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIG 238
            :..||.:....:..|:|......:..:...::|:.. :....||:||:|||:|    ::...|:|
  Fly   180 SWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVG-KVGAGACHGDTGGPIV----DSRGRLVG 239

  Fly   239 IVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            :.:|| :|||. ..|.::.::|.|..||
  Fly   240 VGNWG-VPCGY-GFPDVFARISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 66/251 (26%)
Tryp_SPc 37..266 CDD:214473 64/249 (26%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 64/251 (25%)
Tryp_SPc 45..268 CDD:238113 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.