DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG32808

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:281 Identity:93/281 - (33%)
Similarity:133/281 - (47%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTL 69
            |.|.::|      ||...|           |.::|||.|.|...|::||| .......|.||.||
  Fly    15 TATFLLA------GASGED-----------GKIVNGTTAGPGEFPFVVSL-RRAKSGRHSCGATL 61

  Fly    70 INKDWIVTAAHCI--SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVH------EKYTGGVGPYD 126
            :|..|::|||||:  |.|..:.:..|....|.  ..:|..:|....||      :||..     |
  Fly    62 LNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR--NSSQVARVAAIFVHPGYEPEDKYVN-----D 119

  Fly   127 IALLHVNESFIFNEWVQPATLPSREQVHEGETH--LYGWGQPKSYIFSGA--KTLQTVTTQILNY 187
            ||||.:.:|...:::|||..||...||..|...  |.|||...:   .|.  :.||.|..|:.:.
  Fly   120 IALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNAT---GGVVQQHLQKVKLQVFSD 181

  Fly   188 EECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANM 252
            .||.|.  ....:.:|.||:...:..|..|:|||||||::..::..   :|||||...||.....
  Fly   182 TECSER--HQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQ---VGIVSWSIKPCARPPF 241

  Fly   253 PSIYTKVSAYIDWITNIQSAY 273
            |.::|:||||:|||....::|
  Fly   242 PGVFTEVSAYVDWIVETVNSY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 85/243 (35%)
Tryp_SPc 37..266 CDD:214473 83/240 (35%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 83/241 (34%)
Tryp_SPc 30..258 CDD:238113 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.