DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG32755

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:280 Identity:82/280 - (29%)
Similarity:125/280 - (44%) Gaps:38/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYL--KH---SHICGG 67
            |::|..:....:::....|...|......::.|........|:.||:....:  :|   .|:|||
  Fly     9 LIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGG 73

  Fly    68 TLINKDWIVTAAHCIS----------EPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGV 122
            .:|::..:.:||||.:          :|....::||.......|..||:..|.....|:.|.|..
  Fly    74 AVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGST 138

  Fly   123 GPYDIALLHVNESFIFNEWVQPA--TLP-SREQVHEGETHL-YGWGQPKSYIFSGAKTLQTVTTQ 183
            ...|||||.:|.   |..|..|.  .:| :.:...||.|.| :|||  |..:...:.:||.....
  Fly   139 LENDIALLFLNG---FIPWESPGVRAIPLAIKAPEEGTTCLIHGWG--KVTMKEKSASLQQAPVP 198

  Fly   184 ILNYEECK--EELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIP 246
            |||.|.|:  .:||      .|.:|:..||....||.|||||||:.:     ..|.||:||| :.
  Fly   199 ILNKELCQVIYKLP------ASQMCAGFLQGGIDACQGDSGGPLICD-----GRLAGIISWG-VG 251

  Fly   247 CGLANMPSIYTKVSAYIDWI 266
            |.....|.:||.||.::.||
  Fly   252 CADPGYPGVYTNVSHFLKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 78/251 (31%)
Tryp_SPc 37..266 CDD:214473 76/249 (31%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/250 (30%)
Tryp_SPc 38..273 CDD:238113 78/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.