DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Tmprss6

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:256 Identity:73/256 - (28%)
Similarity:115/256 - (44%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVD 101
            ::.|..:.....|:..||   .::..|||||.||...|::|||||..|                |
  Rat   577 IVGGAMSSEGEWPWQASL---QIRGRHICGGALIADRWVITAAHCFQE----------------D 622

  Fly   102 ELTQQR--QVDFGRVHE--KYTGGVG-----------------PYDIALLHVNESFIFNEWVQPA 145
            .:...|  .|..|::.:  ::.|.|.                 .||:|||.::...:::..|:|.
  Rat   623 SMASPRLWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPV 687

  Fly   146 TLPSREQVHEGETHLY--GWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSS 208
            .||:|....|...|.:  |||..:.. ..|:.|||.|..|::..:.|.|..  ...:....:|:.
  Rat   688 CLPARSHFFEPGQHCWITGWGAQREG-GPGSSTLQKVDVQLIPQDLCNEAY--RYQVTPRMLCAG 749

  Fly   209 SLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNI 269
            ..:..|.||.||||||||.:..:....|.|:|||| :.||..|...:||:|:..::||..:
  Rat   750 YRKGKKDACQGDSGGPLVCKEPSGRWFLAGLVSWG-LGCGRPNFFGVYTRVTRVVNWIQQV 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 73/254 (29%)
Tryp_SPc 37..266 CDD:214473 71/251 (28%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 71/251 (28%)
Tryp_SPc 577..809 CDD:238113 73/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.