DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and CG3795

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:121/290 - (41%) Gaps:39/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLITVTLVIALVAAAQGAKLSDKLAKLV------PSFATGFVINGTEAEPHS-APYIVSL----A 55
            |.:...|:|::.|.:.....:.:|....      ||.....|..|...:.:. ..|.|||    .
  Fly     5 KFVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKP 69

  Fly    56 TNYLKHSHICGGTLINKDWIVTAAHCI------SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRV 114
            ..:...:|.|.||:.::..|:|||||:      .:...:.::||...|......||..:.:....
  Fly    70 KKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLP 134

  Fly   115 HEKYTGGVG-PYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQ 178
            |.||..|.. .|||.|:.:.......:.|....|.::..|......:.|||   :.|..|....:
  Fly   135 HPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWG---TVIQFGPLPDE 196

  Fly   179 TVT--TQILNYEECKEELPESAPIAESN---ICSSSLQQSK-SACNGDSGGPLVVEFTNAPSELI 237
            .:.  .|||....|::.|      ..||   :|::....|. .:|.|||||||:.:     :.:.
  Fly   197 AINGDMQILPDTFCEKLL------GWSNAGMLCANDKHDSDVDSCQGDSGGPLICD-----NMVT 250

  Fly   238 GIVSWGYIPCGLANMPSIYTKVSAYIDWIT 267
            ||||:| :.||..:...|||.|..:.||||
  Fly   251 GIVSFG-MGCGEPDSAGIYTDVYHFRDWIT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 69/249 (28%)
Tryp_SPc 37..266 CDD:214473 66/246 (27%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/235 (29%)
Tryp_SPc 60..278 CDD:214473 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.