DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk8

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:272 Identity:80/272 - (29%)
Similarity:117/272 - (43%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVTLVIALVAA------AQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSH 63
            |..|:..|:.|      |||:|                ::.|.|.:|||.|:..:|   :.....
  Rat    11 TWILLFLLMGAWAGLTRAQGSK----------------ILEGQECKPHSQPWQTAL---FQGERL 56

  Fly    64 ICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGP---- 124
            :|||.|:...|::|||||..:.  .|:..|.|:..:.||..|:.||.....|..:... .|    
  Rat    57 VCGGVLVGDRWVLTAAHCKKDK--YSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSS-NPEDHS 118

  Fly   125 YDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEE 189
            :||.|:.:..|....:.|:|..|.:.......:..:.|||...|...:...||.....:|.:..:
  Rat   119 HDIMLIRLQNSANLGDKVKPIELANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNK 183

  Fly   190 CKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPS 254
            |:...|  ..|.|..:|:.| ......|.||||||||..     ..|.||.|||..|||....|.
  Rat   184 CERAYP--GKITEGMVCAGS-SNGADTCQGDSGGPLVCN-----GVLQGITSWGSDPCGKPEKPG 240

  Fly   255 IYTKVSAYIDWI 266
            :|||:..|.:||
  Rat   241 VYTKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 72/234 (31%)
Tryp_SPc 37..266 CDD:214473 70/232 (30%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.