DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk14

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:271 Identity:78/271 - (28%)
Similarity:118/271 - (43%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGG 67
            |:.:|::.||..|...::..||            ::.|.....:|.|:.|:|.....:. .:|||
  Rat    62 LLLLTILQALAVAIVQSQGDDK------------ILGGYTCVQNSQPWQVALQAGPGRR-FLCGG 113

  Fly    68 TLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQ-----RQVDFGRVHEKYTGGVGPYDI 127
            .|::..|::||||| :.|: :.:..|.|..... |.|||     |||.    |.:|.......|:
  Rat   114 VLLSDQWVITAAHC-ARPL-LHVALGKHNLRRW-EATQQVLRVVRQVP----HPQYRPQAHDNDL 171

  Fly   128 ALLHVNESFIFNEWVQPATLP-SREQVHEG-ETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEEC 190
            .||.:.........|:  |:| :|.....| ...:.|||...|.|......||.|...|:..:.|
  Rat   172 MLLKLQRKVRLGRAVR--TIPVARSCASPGTPCRVSGWGTTASPIVRYPTALQCVNVNIMPEQVC 234

  Fly   191 KEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSI 255
            ....|  ..|....:|:...:..|.:|.||||||||.:     .:|.|:||||...|.:...|.:
  Rat   235 HRAYP--GTITSGMVCAGVPEGGKDSCQGDSGGPLVCQ-----GQLQGLVSWGMERCAMPGYPGV 292

  Fly   256 YTKVSAYIDWI 266
            ||.:..|..||
  Rat   293 YTNLCNYHSWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 71/237 (30%)
Tryp_SPc 37..266 CDD:214473 69/235 (29%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 71/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.