DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk10

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:286 Identity:78/286 - (27%)
Similarity:125/286 - (43%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVIN--GTEAEPHSAPYIVSLATNYLKHSH 63
            :||:...|::.|.||.         |.|:|...|...:.  ||.....|.|:.|||..|.   ..
  Rat    18 VKLLLPLLMMQLWAAQ---------ALLLPGNTTREDLEAFGTLCPSVSQPWQVSLFHNL---QF 70

  Fly    64 ICGGTLINKDWIVTAAHC-ISEPVGMSIIAGLHTRAEVDEL-----TQQRQVDFGRVHEKYTGGV 122
            .|.|.|::::|::||||| .::|        |..|...|.|     .|.|..:....|.||....
  Rat    71 QCAGVLVDQNWVLTAAHCWRNKP--------LRARVGDDHLLLFQSEQLRSTNSPVFHPKYQPCS 127

  Fly   123 GP--------YDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQT 179
            ||        :|:.:|.::...:....|.|..||.:......|..:.|||...:......::|..
  Rat   128 GPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRSLSC 192

  Fly   180 VTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGY 244
            ....:|:.::|:...|   .:..:|:..:.:.:.:.:|..|||||||.:.|     |.||:||..
  Rat   193 SRVTLLSQKQCETFYP---GVITNNMICAGMDRDQDSCQSDSGGPLVCDNT-----LHGILSWSI 249

  Fly   245 IPCGLANM-PSIYTKVSAYIDWITNI 269
            .|||.|.. |::|.|:..|.:||..:
  Rat   250 YPCGAATQYPAVYAKICNYTNWIRRV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 68/248 (27%)
Tryp_SPc 37..266 CDD:214473 66/245 (27%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.