DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk13

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:266 Identity:81/266 - (30%)
Similarity:129/266 - (48%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IALVAAAQGAKLSDKLAKLV--PSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINK 72
            ||.:..|....:|....|::  .:..:||:..|....|||.|:..:|   .::...:|||.|::.
  Rat     8 IACLTLALSGGISRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAAL---LVRGRLLCGGVLVHP 69

  Fly    73 DWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGP------YDIALLH 131
            .|::|||||..:  |.::..|.|....|:...|..:|.....|.:|.  |.|      :||.||.
  Rat    70 KWVLTAAHCRKD--GYTVHLGKHALGRVENGEQAMEVVRSIPHPEYQ--VSPTHLNHDHDIMLLE 130

  Fly   132 VNESFIFNEWVQPATLPSREQVHEGE-THLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELP 195
            :......:..|:...|.:.:.:..|. ..:.|||...|...:..||||....::.:.|||::..|
  Rat   131 LKSPVQLSNHVRTLQLSADDCLPTGTCCRVSGWGTTTSPQVNYPKTLQCANIELRSDEECRQVYP 195

  Fly   196 ESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVS 260
              ..|..:.:|:.:.:..|.:|.|||||||:..     .:|.||:|||..|||..|.|.:||:||
  Rat   196 --GKITANMLCAGTKEGGKDSCEGDSGGPLICN-----GKLYGIISWGDFPCGQPNRPGVYTRVS 253

  Fly   261 AYIDWI 266
            .|:.||
  Rat   254 KYLRWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 74/237 (31%)
Tryp_SPc 37..266 CDD:214473 72/235 (31%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.