DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk6

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_062048.1 Gene:Klk6 / 29245 RGDID:3419 Length:251 Species:Rattus norvegicus


Alignment Length:272 Identity:87/272 - (31%)
Similarity:134/272 - (49%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLITV-TLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSH-I 64
            |::|| ||.:.|:           |||...|.....|::|.....:|.|:..:|.|:    .| :
  Rat     4 KMLTVKTLALCLI-----------LAKSAWSEDQDKVVHGGPCLKNSHPFQAALYTS----GHLL 53

  Fly    65 CGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIAL 129
            |||.|:...|::||||| .:| .:.:..|.|...:.:...:|..||...||.:|.......||.:
  Rat    54 CGGVLVGPQWVLTAAHC-KKP-NLEVYLGKHNLRQTETFQRQISVDRTIVHPRYNPQTHDNDIMM 116

  Fly   130 LHVNESFIFNEWVQPATLPSREQVHE--GETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKE 192
            :|:.....|::.:||  ||.::...|  .:..:.|||:.::..|  ..|:|....|:::.|||:.
  Rat   117 VHLKRPVKFSQRIQP--LPLKKDCSEKNPDCQILGWGKMENGEF--PDTIQCADVQLVSREECER 177

  Fly   193 ELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYT 257
            ..|  ..|..|.:|:...::...:|.||||||||     ....|.||||||.:|||....|.:||
  Rat   178 AYP--GKITRSMVCAGDKREGNDSCQGDSGGPLV-----CGGHLRGIVSWGDMPCGSKEKPGVYT 235

  Fly   258 KVSAYIDWITNI 269
            .|..:|.||.||
  Rat   236 DVCTHIRWIQNI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 75/234 (32%)
Tryp_SPc 37..266 CDD:214473 73/231 (32%)
Klk6NP_062048.1 Tryp_SPc 28..244 CDD:214473 73/232 (31%)
Tryp_SPc 29..247 CDD:238113 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.