DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and KLK13

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:267 Identity:89/267 - (33%)
Similarity:136/267 - (50%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VTLVIALVAAAQGAKLSDKLAKLVPSFAT-GFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTL 69
            :.||||.:..|....:|.:.:|::.:..| ||:..|....|||.|:..:|   .::...:|||.|
Human     4 LALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAAL---LVQGRLLCGGVL 65

  Fly    70 INKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKY----TGGVGPYDIALL 130
            ::..|::|||||:.|  |:.:..|.|....|:...|.|:|.....|.:|    |.....:||.||
Human    66 VHPKWVLTAAHCLKE--GLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLL 128

  Fly   131 HVNESFIFNEWVQPATLPSREQVHEGET-HLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEEL 194
            .:........::|...|....::..|.| .:.|||...|...:..||||....|:.:.|||::..
Human   129 ELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVY 193

  Fly   195 PESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKV 259
            |  ..|.::.:|:.:.:..|.:|.||||||||...|     |.||||||..|||..:.|.:||:|
Human   194 P--GKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRT-----LYGIVSWGDFPCGQPDRPGVYTRV 251

  Fly   260 SAYIDWI 266
            |.|:.||
Human   252 SRYVLWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 79/235 (34%)
Tryp_SPc 37..266 CDD:214473 77/233 (33%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.