DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and KLK5

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:257 Identity:69/257 - (26%)
Similarity:119/257 - (46%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHI-CGGTLINKDWIVTA 78
            |.:.|:..|..::         :|||::.:.|:.|:..:|   .|:.:.: ||..|::..|::||
Human    54 AGEDARSDDSSSR---------IINGSDCDMHTQPWQAAL---LLRPNQLYCGAVLVHPQWLLTA 106

  Fly    79 AHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRV----HEKYTGGVGPYDIALLHVNESFIFN 139
            |||..:...:.:  |.::.:.|.|..||.   |..|    |..|:......|:.|:.:|......
Human   107 AHCRKKVFRVRL--GHYSLSPVYESGQQM---FQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPT 166

  Fly   140 EWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESN 204
            :.|:|..:.|.......:..:.|||..||......|.||.:...:|:.:.|::..|..  |.::.
Human   167 KDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQ--IDDTM 229

  Fly   205 ICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            .|:.. :..:.:|.||||||:|..     ..|.|:||||..||...|.|.:||.:..:..||
Human   230 FCAGD-KAGRDSCQGDSGGPVVCN-----GSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 66/235 (28%)
Tryp_SPc 37..266 CDD:214473 64/233 (27%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 3/22 (14%)
Tryp_SPc 66..285 CDD:214473 64/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.