DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klkb1

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:271 Identity:91/271 - (33%)
Similarity:136/271 - (50%) Gaps:20/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQGAK-LSDKLAKLVPSF-----ATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDW 74
            |||:. .|.:|.|:|.|.     ....::.||.:.....|:.|||....:..:|:|||::|.:.|
  Rat   364 AQGSSGYSLRLCKVVESSDCTTKINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQW 428

  Fly    75 IVTAAHC---ISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESF 136
            |:|||||   |..|....|..|:...:|:...|....:....:|:||....|.|||||:.:....
  Rat   429 ILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPL 493

  Fly   137 IFNEWVQPATLPSREQVHEGETHLY--GWGQPKSYIFSG--AKTLQTVTTQILNYEECKEELPES 197
            .:.|:.:|..|||:...:...|:.:  |||..|.   .|  ...||..|..::..|||:::..:.
  Rat   494 NYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKE---RGETQNILQKATIPLVPNEECQKKYRDY 555

  Fly   198 APIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAY 262
            . |.:..||:...:....||.||||||||.:.:.. .:|:||.|||. .|.....|.:||||:.|
  Rat   556 V-ITKQMICAGYKEGGIDACKGDSGGPLVCKHSGR-WQLVGITSWGE-GCARKEQPGVYTKVAEY 617

  Fly   263 IDWI-TNIQSA 272
            |||| ..|||:
  Rat   618 IDWILEKIQSS 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 80/239 (33%)
Tryp_SPc 37..266 CDD:214473 78/235 (33%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 4/10 (40%)
Tryp_SPc 390..621 CDD:214473 78/236 (33%)
Tryp_SPc 391..621 CDD:238113 78/235 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.