DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk7

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:120/275 - (43%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHIC 65
            :.||||.|.:||..|.||.:                :|:|.:.:..|.|:.|:|......|   |
Mouse     6 LSLITVLLSLALETAGQGER----------------IIDGYKCKEGSHPWQVALLKGNQLH---C 51

  Fly    66 GGTLINKDWIVTAAHCI---------SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGG 121
            ||.|::|.|::|||||.         |:.:|             |:..|:.:......|..|:..
Mouse    52 GGVLVDKYWVLTAAHCKMGQYQVQLGSDKIG-------------DQSAQKIKATKSFRHPGYSTK 103

  Fly   122 VGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILN 186
            ....||.|:.::|....:..|:...||...:.......:.|||...|...:....|.....::::
Mouse   104 THVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLIS 168

  Fly   187 YEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLAN 251
            ..|||:...:.  :.::.:|:.......:.||||||||||...|     |.|:||||..|||..|
Mouse   169 SRECKKVYKDL--LGKTMLCAGIPDSKTNTCNGDSGGPLVCNDT-----LQGLVSWGTYPCGQPN 226

  Fly   252 MPSIYTKVSAYIDWI 266
            .|.:||:|..|..|:
Mouse   227 DPGVYTQVCKYKRWV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 67/239 (28%)
Tryp_SPc 37..266 CDD:214473 66/237 (28%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 66/254 (26%)
Serine protease. /evidence=ECO:0000250 26..246 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.