DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and F12

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_000496.2 Gene:F12 / 2161 HGNCID:3530 Length:615 Species:Homo sapiens


Alignment Length:266 Identity:88/266 - (33%)
Similarity:123/266 - (46%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI 82
            |.:|...|:.:..      |:.|..|...:.|||.:|   |..|| .|.|:||...|::|||||:
Human   360 GQRLRKSLSSMTR------VVGGLVALRGAHPYIAAL---YWGHS-FCAGSLIAPCWVLTAAHCL 414

  Fly    83 SE---PVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNES-----FIFN 139
            .:   |..::::.|...|....|..|...|...|:||.::.....:|:|||.:.|.     .:.:
Human   415 QDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLS 479

  Fly   140 EWVQPATLPSREQVHEGETHL---YGWGQPKSYIFSGAKT----LQTVTTQILNYEECKEELPES 197
            .:|||..||| ......||.|   .|||    :.|.||:.    ||......|:.|.|.......
Human   480 PYVQPVCLPS-GAARPSETTLCQVAGWG----HQFEGAEEYASFLQEAQVPFLSLERCSAPDVHG 539

  Fly   198 APIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELI--GIVSWGYIPCGLANMPSIYTKVS 260
            :.|....:|:..|:....||.||||||||.|...|...|.  ||:||| ..||..|.|.:||.|:
Human   540 SSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWG-SGCGDRNKPGVYTDVA 603

  Fly   261 AYIDWI 266
            .|:.||
Human   604 YYLAWI 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 85/247 (34%)
Tryp_SPc 37..266 CDD:214473 83/245 (34%)
F12NP_000496.2 FN2 41..88 CDD:128373
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
Kringle 217..295 CDD:278480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359
Tryp_SPc 372..609 CDD:214473 83/252 (33%)
Tryp_SPc 373..612 CDD:238113 85/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.