DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Prtn3

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:129/275 - (46%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVIALV--AAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLI 70
            |::|||  .|.|.:|                ::.|.||.|||.||:.||..:....||.||||||
Mouse    15 LLLALVVGGAVQASK----------------IVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLI 63

  Fly    71 NKDWIVTAAHCISEPVG--MSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGP----YDIAL 129
            :..:::|||||:.:...  ::::.|.|     |.|:.:.:.....:.:.:.....|    .|:.|
Mouse    64 HPRFVLTAAHCLQDISWQLVTVVLGAH-----DLLSSEPEQQKFTISQVFQNNYNPEENLNDVLL 123

  Fly   130 LHVNESFIFNEWVQPATLPSREQ-VHEGETHL-YGWGQPKSYIFSGAKT---LQTVTTQILNYEE 189
            |.:|.:....:.|..|:||.::| :.:|...| .|||:    :.:.|.|   ||.:...::.: .
Mouse   124 LQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGR----LGTQAPTPRVLQELNVTVVTF-L 183

  Fly   190 CKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPS 254
            |:|.          |:|:...:::...|.|||||||:..     ..|.|:.|:....|.....|.
Mouse   184 CREH----------NVCTLVPRRAAGICFGDSGGPLICN-----GILHGVDSFVIRECASLQFPD 233

  Fly   255 IYTKVSAYIDWITNI 269
            .:.:||.|:|||.|:
Mouse   234 FFARVSMYVDWIQNV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 69/242 (29%)
Tryp_SPc 37..266 CDD:214473 67/239 (28%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 68/256 (27%)
Tryp_SPc 30..248 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.